What Is Ll 37?
Respuesta Rápida
Descripción General LL-37 es un péptido antimicrobiano (AMP) catiónico de 37 residuos y el único miembro de la familia de las catelicidinas identificado en humanos. Su secuencia de aminoácidos es [LL-37, 37 aa][1] Molécula precursora: LL-37 se deriva de una proteína precursor...
Descripción General
LL-37 es un péptido antimicrobiano (AMP) catiónico de 37 residuos y el único miembro de la familia de las catelicidinas identificado en humanos. Su secuencia de aminoácidos es [LL-37, 37 aa][1]
Molécula precursora: LL-37 se deriva de una proteína precursora más grande e inactiva llamada hCAP18 (Proteína Antimicrobiana Catiónica humana, 18 kDa). El gen CAMP en el cromosoma 3p21.3 codifica hCAP18. El péptido activo LL-37 se libera extracelularmente mediante escisión proteolítica — principalmente por la proteinasa 3 en neutrófilos y las calicreínas (K5/K7) en queratinocitos.[2]
Origen celular: Se expresa de forma constitutiva o inducida en neutrófilos (almacenado en gránulos específicos), monocitos, mastocitos y células epiteliales de la piel, el tracto gastrointestinal y el tracto respiratorio.[3]
Estructuralmente, LL-37 es un péptido lineal, anfipático (PM 4493,33 Da) con una carga neta de +6 a pH fisiológico. Es libre de cisteína y adopta una estructura α-helicoidal en entornos de membrana, pero permanece desordenado en solución acuosa. Los estudios de RMN revelan un motivo hélice-curvatura-hélice curvado que abarca los residuos 2–31 con una cola C-terminal desordenada.[1]
La expresión de LL-37 en la piel está regulada por la vitamina D. Los niveles anormales de LL-37 están vinculados a la psoriasis (sobreexpresión) y a la dermatitis atópica (supresión).[6]
Referencias
- Johansson J, Gudmundsson GH, Rottenberg ME, et al. Conformation-dependent antibacterial activity of the naturally occurring human peptide LL-37. Journal of Biological Chemistry. 1998;273(6):3718-3724.
- Gudmundsson GH, Agerberth B, Odeberg J, et al. The human gene FALL39 and processing of the cathelin precursor to the antibacterial peptide LL-37 in granulocytes. European Journal of Biochemistry. 1996;238(2):325-332.
- Ridyard KE, Overhage J. The Potential of Human Peptide LL-37 as an Antimicrobial and Anti-Biofilm Agent. Antibiotics. 2021;10(6):650.
- Duplantier AJ, van Hoek ML. The Human Cathelicidin Antimicrobial Peptide LL-37 as a Potential Treatment for Polymicrobial Infected Wounds. Frontiers in Immunology. 2013;4:143.
- Grönberg A, Mahlapuu M, Ståhle M, et al. Treatment with LL-37 is Safe and Effective in Enhancing Healing of Hard-to-Heal Venous Leg Ulcers: A Randomized, Placebo-Controlled Clinical Trial. Wound Repair and Regeneration. 2014;22(5):613-621.
- Yang B, Good D, Mosaiab T, et al. Significance of LL-37 on Immunomodulation and Disease Outcome. BioMed Research International. 2020;2020:8349712.
- Heilborn JD, Nilsson MF, Kratz G, et al. The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epithelium. Journal of Investigative Dermatology. 2003;120(3):379-389.
- Scott MG, Davidson DJ, Gold MR, et al. The human antimicrobial peptide LL-37 is a multifunctional modulator of innate immune responses. The Journal of Immunology. 2002;169(7):3883-3891.
- Svensson D, Nilsson BO. Human antimicrobial/host defense peptide LL-37 may prevent the spread of a local infection through multiple mechanisms: an update. Inflammation Research. 2025;74(1):36.
- Piktel E, Niemirowicz K, Wnorowska U, et al. The Role of Cathelicidin LL-37 in Cancer Development. Archivum Immunologiae et Therapiae Experimentalis. 2016;64(1):33-46.
- Zhang Z, Chen WQ, Zhang SQ, et al. The human cathelicidin peptide LL-37 inhibits pancreatic cancer growth by suppressing autophagy and reprogramming of the tumor immune microenvironment. Frontiers in Pharmacology. 2022;13:906625.
- Lu F, Zhu Y, Zhang G, Liu Z. Renovation as innovation: Repurposing human antibacterial peptide LL-37 for cancer therapy. Frontiers in Pharmacology. 2022;13:944147.
- Miranda E, Bramono K, Yunir E, et al. Efficacy of LL-37 cream in enhancing healing of diabetic foot ulcer: a randomized double-blind controlled trial. Archives of Dermatological Research. 2023;315(9):2623-2633.
- Seil M, Nagant C, Dehaye JP, et al. Spotlight on Human LL-37, an Immunomodulatory Peptide with Promising Cell-Penetrating Properties. Pharmaceuticals. 2010;3(11):3435-3460.
- Ergün FC, Kars MD, Kars G. Development and Characterization of LL37 Antimicrobial-Peptide-Loaded Chitosan Nanoparticles. Polymers. 2025;17(13):1884.
- Mahlapuu M, Sidorowicz A, Mikosinski J, et al. Evaluation of LL-37 in healing of hard-to-heal venous leg ulcers: A multicentric prospective randomized placebo-controlled clinical trial. Wound Repair and Regeneration. 2021;29(6):938-950.
- Ohuchi K, Ikawa T, Amagai R, et al. LL-37 Might Promote Local Invasion of Melanoma by Activating Melanoma Cells and Tumor-Associated Macrophages. Cancers. 2023;15(6):1678.
- Miura S, Garcet S, Li X, et al. Cathelicidin Antimicrobial Peptide LL37 Induces Toll-Like Receptor 8 and Amplifies IL-36γ and IL-17C in Human Keratinocytes. Journal of Investigative Dermatology. 2023;143(5):832-841.e4.
- Lin X, Wang R, Mai S. Advances in delivery systems for the therapeutic application of LL37. Journal of Drug Delivery Science and Technology. 2020;60(9):102016.
- Wu WK, Wang G, Coffelt SB, et al. Emerging Roles of the Host Defense Peptide LL-37 in Human Cancer and its Potential Therapeutic Applications. International Journal of Cancer. 2010;127(8):1741-1747.
- Alalwani SM, Sierigk J, Herr C, et al. The antimicrobial peptide LL-37 modulates the inflammatory and host defense response of human neutrophils. European Journal of Immunology. 2010;40(4):1118-1126.
- Lozeau LD, Kole D, Dominko T, et al. Activity and toxicity of a recombinant LL37 antimicrobial peptide. Frontiers in Bioengineering and Biotechnology. 2016.
- Wan W, Zhang L, Lin Y, et al. Mitochondria-derived peptide MOTS-c: effects and mechanisms related to stress, metabolism and aging. Journal of Translational Medicine. 2023;21(1):36.
- M.D. Anderson Cancer Center. Induction of Antitumor Response in Melanoma Patients Using the Antimicrobial Peptide LL37. ClinicalTrials.gov Protocol NCT02225366. 2015.
Preguntas de Investigación Relacionadas
Desea la revisión completa de la investigación?
Ver Página Completa de Investigación de Ll 37→SOLO PARA USO EN INVESTIGACIÓN
Este contenido se proporciona solo para fines educativos e informativos. Los productos se suministran exclusivamente para estudios in vitro y no son medicamentos, fármacos ni suplementos. No están aprobados por la FDA para prevenir, tratar o curar ninguna condición.
